PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_13757
Common NameKK1_014179
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 221aa    MW: 25662.8 Da    PI: 5.7327
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_13757genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.9e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l+ +++++G  +W++ ++  g+ R++k+c++rw++yl
    C.cajan_13757 14 KGAWTPEEDRKLIAYITKYGHWNWRLLPKFAGLARCGKSCRLRWLNYL 61
                     79******************99************************97 PP

2Myb_DNA-binding59.38.2e-1967110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++ eE+e +v+++++lG++ W++Ia++++ gRt++++k++w++
    C.cajan_13757  67 RGNFSREEEETIVKLHEKLGNR-WSAIAAELP-GRTDNEIKNHWHT 110
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.9E-25564IPR009057Homeodomain-like
PROSITE profilePS5129416.732961IPR017930Myb domain
SuperFamilySSF466894.77E-3011108IPR009057Homeodomain-like
SMARTSM007179.9E-121363IPR001005SANT/Myb domain
PfamPF002491.6E-141461IPR001005SANT/Myb domain
CDDcd001674.96E-91661No hitNo description
PROSITE profilePS5129427.74162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2665116IPR009057Homeodomain-like
SMARTSM007175.0E-1766114IPR001005SANT/Myb domain
PfamPF002497.5E-1767110IPR001005SANT/Myb domain
CDDcd001677.74E-1169110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MVRTPCCDQN GLKKGAWTPE EDRKLIAYIT KYGHWNWRLL PKFAGLARCG KSCRLRWLNY  60
LRPDVKRGNF SREEEETIVK LHEKLGNRWS AIAAELPGRT DNEIKNHWHT ALKKRIEKKS  120
SEAKRETAKE KLPKSMETVL ENHSDSYTTD AAAAAAATNR ENWVPEIDDD YFFSVDAYTE  180
SAVCADFWTE PYLVDNSYVP PEYDVELWSQ NELYECEGLF S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-30121175109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003541925.11e-115PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH42e-64MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A151SVG11e-165A0A151SVG1_CAJCA; Myb-related protein Myb4
STRINGGLYMA13G37903.11e-114(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.12e-64myb domain protein 14